PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma6g00550.1
Common NameZOSMA_6G00550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family MIKC_MADS
Protein Properties Length: 226aa    MW: 26126.3 Da    PI: 10.1051
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma6g00550.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.92.7e-28959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krienk+nrqvtfskRr g+lKKA+E+SvLCd++ av ifs++gkl eys+
  Zosma6g00550.1  9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDVQLAVAIFSTKGKLSEYST 59
                    79***********************************************96 PP

2K-box51.93.2e-18901431770
           K-box  17 lqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKn 70 
                      + e +kL +++e+L + qR+++GedL+++s +eL +LeqqL+++l kiR +K+
  Zosma6g00550.1  90 RSFECTKLMNKVESLHKIQRNIIGEDLDDMSSRELYSLEQQLQNGLYKIRMQKS 143
                     45699**********************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.4E-35160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.997161IPR002100Transcription factor, MADS-box
CDDcd002652.46E-35272No hitNo description
SuperFamilySSF554557.85E-30278IPR002100Transcription factor, MADS-box
PRINTSPR004046.5E-28323IPR002100Transcription factor, MADS-box
PfamPF003191.8E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004046.5E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004046.5E-283859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129710.70887205IPR002487Transcription factor, K-box
PfamPF014863.6E-1690194IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MGRGRVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD VQLAVAIFST KGKLSEYSTD  60
SNMANILERY EKRYGEKYLH QPKIQYEGQR SFECTKLMNK VESLHKIQRN IIGEDLDDMS  120
SRELYSLEQQ LQNGLYKIRM QKSSGQLHIH AVLLISDFNI NFMMQNHRIL DLIANLQTKG  180
NLIQNENEAL QKMIITEKAA QMEREKLKAT KNLPHIPNLN LACLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A1e-16270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-16270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-16270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D1e-16270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_P1e-16178176Myocyte-specific enhancer factor 2B
1tqe_Q1e-16178176Myocyte-specific enhancer factor 2B
1tqe_R1e-16178176Myocyte-specific enhancer factor 2B
1tqe_S1e-16178176Myocyte-specific enhancer factor 2B
3mu6_A1e-16270168Myocyte-specific enhancer factor 2A
3mu6_B1e-16270168Myocyte-specific enhancer factor 2A
3mu6_C1e-16270168Myocyte-specific enhancer factor 2A
3mu6_D1e-16270168Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009408635.11e-54PREDICTED: truncated transcription factor CAULIFLOWER A-like
SwissprotQ412749e-52AGL8_SINAL; Agamous-like MADS-box protein AGL8 homolog
SwissprotQ412761e-51AP1_SINAL; Floral homeotic protein APETALA 1
TrEMBLA0A0K9NQV41e-165A0A0K9NQV4_Z
STRINGGSMUA_Achr7P00460_0014e-54(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.16e-52MIKC_MADS family protein